![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein automated matches [190091] (20 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188447] (892 PDB entries) |
![]() | Domain d4bcfa_: 4bcf A: [251194] Other proteins in same PDB: d4bcfb1, d4bcfb2 automated match to d4imya_ complexed with t6q |
PDB Entry: 4bcf (more details), 3.01 Å
SCOPe Domain Sequences for d4bcfa_:
Sequence, based on SEQRES records: (download)
>d4bcfa_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} dsvecpfcdevskyeklakigqgtfgevfkarhrktgqkvalkkvlmenekegfpitalr eikilqllkhenvvnlieicrtkaspynrckasiylvfdfcehdlagllsnvlvkftlse ikrvmqmllnglyyihrnkilhrdmkaanvlitrdgvlkladfglarafslaknsqpnry tnrvvtlwyrppelllgerdygppidlwgagcimaemwtrspimqgnteqhqlalisqlc gsitpevwpnvdnyelyeklelvkgqkrkvkdrlkayvrdpyaldlidkllvldpaqrid sddalnhdffwsdpmpsdlkg
>d4bcfa_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} dsvecpfcdevskyeklakigqgtfgevfkarhrktgqkvalkkvlmenekegfpitalr eikilqllkhenvvnlieicrtkasiylvfdfcehdlagllsnvlvkftlseikrvmqml lnglyyihrnkilhrdmkaanvlitrdgvlkladfglarafslpnrytnrvvtlwyrppe lllgerdygppidlwgagcimaemwtrspimqgnteqhqlalisqlcgsitpevwpnvdn yelyeklelvkgqkrkvkdrlkayvrdpyaldlidkllvldpaqridsddalnhdffwsd pmpsdlkg
Timeline for d4bcfa_: