SCOPe 2.08: Domain d4ba8a1: 4ba8 A:3-102

Lineage for d4ba8a1 (4ba8 A:3-102)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d4ba8a1: 4ba8 A:3-102 [251193]
   Other proteins in same PDB: d4ba8a2
   automated match to d4dz8a1

Details for d4ba8a1

PDB Entry: 4ba8

PDB Description: High resolution NMR structure of the C mu3 domain from IgM

PDB Compounds: (A:) ig mu chain c region secreted form

SCOPe Domain Sequences for d4ba8a1:

Sequence; same for both SEQRES and ATOM records:

>d4ba8a1 b.1.1.0 (A:3-102) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diltftippsfadiflsksanltclvsnlatyetlniswasqsgepletkikvmeshpng
tfsakgvasvsvedwnnrkefvctvthrdlpspqkkfisk

Timeline for d4ba8a1:

• d4ba8a1 first appeared in SCOPe 2.04, called d4ba8a_
  
• d4ba8a1 appears in SCOPe 2.07