Lineage for d4b8oa_ (4b8o A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006908Family a.118.1.0: automated matches [191340] (1 protein)
    not a true family
  6. 2006909Protein automated matches [190220] (14 species)
    not a true protein
  7. 2006988Species Oryza sativa [TaxId:39947] [226552] (2 PDB entries)
  8. 2006990Domain d4b8oa_: 4b8o A: [251185]
    automated match to d1q1sc_

Details for d4b8oa_

PDB Entry: 4b8o (more details), 2.08 Å

PDB Description: rImp_alpha_SV40TAgNLS
PDB Compounds: (A:) importin subunit alpha-1a

SCOPe Domain Sequences for d4b8oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4b8oa_ a.118.1.0 (A:) automated matches {Oryza sativa [TaxId: 39947]}
slpamiggvysddnnlqleattqfrkllsiersppieeviqsgvvprfvqfltredfpql
qfeaawaltniasgtsentkvvidhgavpifvkllgsssddvreqavwalgnvagdspkc
rdlvlangallpllaqlnehtklsmlrnatwtlsnfcrgkpqpsfeqtrpalpalarlih
sndeevltdacwalsylsdgtndkiqavieagvcprlvelllhpspsvlipalrtvgniv
tgddaqtqciidhqalpcllslltqnlkksikkeacwtisnitagnkdqiqavinagiig
plvnllqtaefdikkeaawaisnatsggshdqikylvsegcikplcdllicpdirivtvc
leglenilkvgetdktlaagdvnvfsqmideaeglekienlqshdnneiyekavkileay
wm

SCOPe Domain Coordinates for d4b8oa_:

Click to download the PDB-style file with coordinates for d4b8oa_.
(The format of our PDB-style files is described here.)

Timeline for d4b8oa_: