![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.68.1: Sialidases [50939] (3 families) ![]() |
![]() | Family b.68.1.0: automated matches [191452] (1 protein) not a true family |
![]() | Protein automated matches [190692] (11 species) not a true protein |
![]() | Species Influenza a virus (a/california/07/2009(h1n1)) [TaxId:641809] [193484] (2 PDB entries) |
![]() | Domain d4b7qc_: 4b7q C: [251182] automated match to d4b7ra_ complexed with ca, nag, zmr; mutant |
PDB Entry: 4b7q (more details), 2.73 Å
SCOPe Domain Sequences for d4b7qc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4b7qc_ b.68.1.0 (C:) automated matches {Influenza a virus (a/california/07/2009(h1n1)) [TaxId: 641809]} vklagnsslcpvsgwaiyskdnsvrigskgdvfvirepfiscsplecrtffltqgallnd khsngtikdrspyrtlmscpigevpspynsrfesvawsasachdginwltigisgpdnga vavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpsngqasykifriekgk ivksvemnapnyhyeecscypdsseitcvcrdnwhgsnrpwvsfnqnleyqigyicsgif gdnprpndktgscgpvssngangvkgfsfkygngvwigrtksissrngfemiwdpngwtg tdnnfsikqdivginewsgysgsfvqhpeltgldcirpcfwvelirgrpkentiwtsgss isfcgvnsdtvgwswpdgaelpftidk
Timeline for d4b7qc_: