Lineage for d4b7na_ (4b7n A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1802176Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 1802177Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 1802584Family b.68.1.0: automated matches [191452] (1 protein)
    not a true family
  6. 1802585Protein automated matches [190692] (11 species)
    not a true protein
  7. 1802605Species Influenza a virus (a/netherlands/2631/2010(h1n1)) [TaxId:1027873] [256197] (2 PDB entries)
  8. 1802608Domain d4b7na_: 4b7n A: [251179]
    automated match to d4b7ra_
    complexed with ca, nag, zmr; mutant

Details for d4b7na_

PDB Entry: 4b7n (more details), 2.84 Å

PDB Description: H1N1 2009 Pandemic Influenza Virus: Resistance of the I223R Neuraminidase Mutant Explained by Kinetic and Structural Analysis
PDB Compounds: (A:) Neuraminidase

SCOPe Domain Sequences for d4b7na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4b7na_ b.68.1.0 (A:) automated matches {Influenza a virus (a/netherlands/2631/2010(h1n1)) [TaxId: 1027873]}
vklagnsslcpvsgwaiyskdnsirigskgdvfvirepfiscsplecrtffltqgallnd
khsngtikdrspyrtlmscpigevpspynsrfesvawsasachdginwltigisgpdnga
vavlkyngiitdtikswrnnrlrtqesecacvngscftvmtdgpsdgqasykifriekgk
ivksvemnapnyhyeecscypdsseitcvcrdnwhgsnrpwvsfnqnleyqigyicsgif
gdnprpndktgscgpvssngangvkgfsfkygngvwigrtksissrngfemiwdpngwtg
tdndfsikqdivginewsgysgsfvqhpeltgldcirpcfwvelirgrpkentiwtsgss
isfcgvnsdtvgwswpdgaelpftid

SCOPe Domain Coordinates for d4b7na_:

Click to download the PDB-style file with coordinates for d4b7na_.
(The format of our PDB-style files is described here.)

Timeline for d4b7na_: