Class b: All beta proteins [48724] (180 folds) |
Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
Superfamily b.68.1: Sialidases [50939] (3 families) |
Family b.68.1.0: automated matches [191452] (1 protein) not a true family |
Protein automated matches [190692] (20 species) not a true protein |
Species Influenza A virus (a/netherlands/2631/2010(h1n1)) [TaxId:1027873] [256197] (2 PDB entries) |
Domain d4b7mb_: 4b7m B: [251178] automated match to d4b7ra_ complexed with ca, nag, po4; mutant |
PDB Entry: 4b7m (more details), 2.5 Å
SCOPe Domain Sequences for d4b7mb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4b7mb_ b.68.1.0 (B:) automated matches {Influenza A virus (a/netherlands/2631/2010(h1n1)) [TaxId: 1027873]} vklagnsslcpvsgwaiyskdnsirigskgdvfvirepfiscsplecrtffltqgallnd khsngtikdrspyrtlmscpigevpspynsrfesvawsasachdginwltigisgpdnga vavlkyngiitdtikswrnnrlrtqesecacvngscftvmtdgpsdgqasykifriekgk ivksvemnapnyhyeecscypdsseitcvcrdnwhgsnrpwvsfnqnleyqigyicsgif gdnprpndktgscgpvssngangvkgfsfkygngvwigrtksissrngfemiwdpngwtg tdndfsikqdivginewsgysgsfvqhpeltgldcirpcfwvelirgrpkentiwtsgss isfcgvnsdtvgwswpdgaelpftid
Timeline for d4b7mb_: