![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.68.1: Sialidases [50939] (3 families) ![]() |
![]() | Family b.68.1.0: automated matches [191452] (1 protein) not a true family |
![]() | Protein automated matches [190692] (11 species) not a true protein |
![]() | Species Influenza a virus (a/netherlands/2631/2010(h1n1)) [TaxId:1027873] [256197] (2 PDB entries) |
![]() | Domain d4b7ma_: 4b7m A: [251177] automated match to d4b7ra_ complexed with ca, nag, po4; mutant |
PDB Entry: 4b7m (more details), 2.5 Å
SCOPe Domain Sequences for d4b7ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4b7ma_ b.68.1.0 (A:) automated matches {Influenza a virus (a/netherlands/2631/2010(h1n1)) [TaxId: 1027873]} vklagnsslcpvsgwaiyskdnsirigskgdvfvirepfiscsplecrtffltqgallnd khsngtikdrspyrtlmscpigevpspynsrfesvawsasachdginwltigisgpdnga vavlkyngiitdtikswrnnrlrtqesecacvngscftvmtdgpsdgqasykifriekgk ivksvemnapnyhyeecscypdsseitcvcrdnwhgsnrpwvsfnqnleyqigyicsgif gdnprpndktgscgpvssngangvkgfsfkygngvwigrtksissrngfemiwdpngwtg tdndfsikqdivginewsgysgsfvqhpeltgldcirpcfwvelirgrpkentiwtsgss isfcgvnsdtvgwswpdgaelpftid
Timeline for d4b7ma_: