Lineage for d4ayna1 (4ayn A:200-320)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2575768Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 2575769Superfamily f.4.1: OMPA-like [56925] (5 families) (S)
    forms (8,10) barrel
  5. 2575840Family f.4.1.0: automated matches [191664] (1 protein)
    not a true family
  6. 2575841Protein automated matches [191257] (5 species)
    not a true protein
  7. 2575864Species Neisseria meningitidis [TaxId:487] [256195] (2 PDB entries)
  8. 2575865Domain d4ayna1: 4ayn A:200-320 [251169]
    Other proteins in same PDB: d4ayna2
    automated match to d1ys5a1
    complexed with so4

Details for d4ayna1

PDB Entry: 4ayn (more details), 2.06 Å

PDB Description: structure of the c-terminal barrel of neisseria meningitidis fhbp variant 2
PDB Compounds: (A:) factor h-binding protein

SCOPe Domain Sequences for d4ayna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ayna1 f.4.1.0 (A:200-320) automated matches {Neisseria meningitidis [TaxId: 487]}
ggehtafnqlpsgkaeyhgkafssddpngrlhysidftkkqgygriehlktpeqnvelas
aelkadekshavilgdtrygseekgtyhlalfgdraqeiagsatvkirekvheigiagkq

SCOPe Domain Coordinates for d4ayna1:

Click to download the PDB-style file with coordinates for d4ayna1.
(The format of our PDB-style files is described here.)

Timeline for d4ayna1: