SCOPe 2.05: Domain d4axob_: 4axo B:

Lineage for d4axob_ (4axo B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.0: automated matches [191354] (1 protein)
   not a true family

6. Protein automated matches [190388] (20 species)
   not a true protein

7. Species Clostridium difficile [TaxId:272563] [256193] (1 PDB entry)

8. Domain d4axob_: 4axo B: [251168]
   automated match to d2pytb_
   complexed with mg

Details for d4axob_

PDB Entry: 4axo, 1 Å

PDB Description: structure of the clostridium difficile eutq protein

PDB Compounds: (B:) ethanolamine utilization protein

SCOPe Domain Sequences for d4axob_:

Sequence; same for both SEQRES and ATOM records:

>d4axob_ b.82.1.0 (B:) automated matches {Clostridium difficile [TaxId: 272563]}
tvdfvrnkdisgitsiklptvkvsesdrldtgnpsdvvytkdlftleesprlgcgmmemk
ettfdwtlnydeidyvidgtldiiidgrkvsassgelifipkgskiqfsvpdyarfiyvt
ypadwasqnlehhhhhh

Timeline for d4axob_:

• d4axob_ first appeared in SCOPe 2.04
  
• d4axob_ is called d4axob1 in SCOPe 2.06
  
• d4axob_ appears in the current release, SCOPe 2.08, called d4axob1