Lineage for d4ax0b_ (4ax0 B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2231215Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2231216Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2231713Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2231714Protein automated matches [190418] (18 species)
    not a true protein
  7. 2231844Species Pseudomonas aeruginosa [TaxId:287] [187706] (16 PDB entries)
  8. 2231850Domain d4ax0b_: 4ax0 B: [251163]
    automated match to d2fu9a_
    complexed with act, ca, zn; mutant

Details for d4ax0b_

PDB Entry: 4ax0 (more details), 1.74 Å

PDB Description: q157a mutant. crystal structure of the mobile metallo-beta-lactamase aim-1 from pseudomonas aeruginosa: insights into antibiotic binding and the role of gln157
PDB Compounds: (B:) metallo-beta-lactamase aim-1

SCOPe Domain Sequences for d4ax0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ax0b_ d.157.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
asrgcaddagwndpamplkvygntwyvgtcgisallvtsdaghilvdaatpqagpqilan
iralgfrpedvraivfshehfdhagslaelqkatgapvyarapaidtlkrglpdrtdpaf
evaepvapvanivtladdgvvsvgplaltavaspghtpggtswtwrscegddcrqmvyad
sltaisddvfrysddaahpgylaafrntlarvaaldcdilvtphpsasglwnrigpraaa
plmdttacrryaqgarqrlekrlaeeaats

SCOPe Domain Coordinates for d4ax0b_:

Click to download the PDB-style file with coordinates for d4ax0b_.
(The format of our PDB-style files is described here.)

Timeline for d4ax0b_: