Lineage for d4awza_ (4awz A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2997604Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2997605Protein automated matches [190418] (31 species)
    not a true protein
  7. 2997930Species Pseudomonas aeruginosa [TaxId:287] [187706] (20 PDB entries)
  8. 2997938Domain d4awza_: 4awz A: [251160]
    automated match to d2fu9a_
    complexed with ca, mg, zn

Details for d4awza_

PDB Entry: 4awz (more details), 1.8 Å

PDB Description: Crystal Structure of the Mobile Metallo-beta-Lactamase AIM-1 from Pseudomonas aeruginosa: Insights into Antibiotic Binding and the role of Gln157
PDB Compounds: (A:) metallo-beta-lactamase aim-1

SCOPe Domain Sequences for d4awza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4awza_ d.157.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
asrgcaddagwndpamplkvygntwyvgtcgisallvtsdaghilvdaatpqagpqilan
iralgfrpedvraivfshehfdhagslaelqkatgapvyarapaidtlkrglpdrtdpqf
evaepvapvanivtladdgvvsvgplaltavaspghtpggtswtwrscegddcrqmvyad
sltaisddvfrysddaahpgylaafrntlarvaaldcdilvtphpsasglwnrigpraaa
plmdttacrryaqgarqrlekrlaeeaat

SCOPe Domain Coordinates for d4awza_:

Click to download the PDB-style file with coordinates for d4awza_.
(The format of our PDB-style files is described here.)

Timeline for d4awza_: