Lineage for d4av7d2 (4av7 D:539-660)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2209077Fold d.106: SCP-like [55717] (1 superfamily)
    alpha-beta(3)-(crossover)-beta-(alpha)-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 32145
  4. 2209078Superfamily d.106.1: SCP-like [55718] (5 families) (S)
  5. 2209139Family d.106.1.0: automated matches [191568] (1 protein)
    not a true family
  6. 2209140Protein automated matches [190987] (4 species)
    not a true protein
  7. 2209144Species Pseudomonas sp. [TaxId:1007495] [226383] (3 PDB entries)
  8. 2209156Domain d4av7d2: 4av7 D:539-660 [251154]
    Other proteins in same PDB: d4av7a1, d4av7a3, d4av7b1, d4av7b3, d4av7c1, d4av7c3, d4av7d1, d4av7d3, d4av7e1, d4av7e3, d4av7f1, d4av7f3
    automated match to d4axha2
    complexed with so4, zn; mutant

Details for d4av7d2

PDB Entry: 4av7 (more details), 3 Å

PDB Description: Structure determination of the double mutant S233Y F250G from the sec- alkyl sulfatase PisA1
PDB Compounds: (D:) sec-alkylsulfatase

SCOPe Domain Sequences for d4av7d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4av7d2 d.106.1.0 (D:539-660) automated matches {Pseudomonas sp. [TaxId: 1007495]}
gksemgraltpdmffdllairldtdkavghdmtlnwvfedlkqdialtlrngvltqrvgs
lnpkadvtvkltkptldqiaarkldlptaikqgtvkldgdgkklgeffglldsfspkfni
ve

SCOPe Domain Coordinates for d4av7d2:

Click to download the PDB-style file with coordinates for d4av7d2.
(The format of our PDB-style files is described here.)

Timeline for d4av7d2: