Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.106: SCP-like [55717] (1 superfamily) alpha-beta(3)-(crossover)-beta-(alpha)-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 32145 |
Superfamily d.106.1: SCP-like [55718] (5 families) |
Family d.106.1.0: automated matches [191568] (1 protein) not a true family |
Protein automated matches [190987] (4 species) not a true protein |
Species Pseudomonas sp. [TaxId:1007495] [226383] (3 PDB entries) |
Domain d4av7d2: 4av7 D:539-660 [251154] Other proteins in same PDB: d4av7a1, d4av7a3, d4av7b1, d4av7b3, d4av7c1, d4av7c3, d4av7d1, d4av7d3, d4av7e1, d4av7e3, d4av7f1, d4av7f3 automated match to d4axha2 complexed with so4, zn; mutant |
PDB Entry: 4av7 (more details), 3 Å
SCOPe Domain Sequences for d4av7d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4av7d2 d.106.1.0 (D:539-660) automated matches {Pseudomonas sp. [TaxId: 1007495]} gksemgraltpdmffdllairldtdkavghdmtlnwvfedlkqdialtlrngvltqrvgs lnpkadvtvkltkptldqiaarkldlptaikqgtvkldgdgkklgeffglldsfspkfni ve
Timeline for d4av7d2: