Lineage for d4atqh_ (4atq H:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2132280Species Arthrobacter aurescens [TaxId:290340] [234095] (2 PDB entries)
  8. 2132300Domain d4atqh_: 4atq H: [251142]
    automated match to d4atpa_
    complexed with abu, plp

Details for d4atqh_

PDB Entry: 4atq (more details), 2.75 Å

PDB Description: GABA-transaminase A1R958 in complex with external aldimine PLP-GABA adduct
PDB Compounds: (H:) 4-aminobutyrate transaminase

SCOPe Domain Sequences for d4atqh_:

Sequence, based on SEQRES records: (download)

>d4atqh_ c.67.1.0 (H:) automated matches {Arthrobacter aurescens [TaxId: 290340]}
syrieqkrningafpgpksqalaerrsavvaagvasgvpvyvedadggiirdvdgnsfid
lgsgiavtsvgasdpavvaavqeaaahfthtcfmvtpyegyvavteqlnrltpgdhakrt
vlfnsgaeavenavkvarlatgrdavvafdhayhgrtnltmaltakampyktnfgpfape
vyrmpmsypfreenpeitgaeaakraitmiekqiggdqvaaiiiepiqgeggfivpaegf
lpalsewakekgivfiadevqsgfcrtgewfavdhegvvpdiitmakgiagglplsaitg
radlldavhpgglggtyggnpvacaaalaaidtmeqhdlngrarhieelalgklrelaae
lsagggsvvgdirgrgamlaielvqpgskepnaeltkavaaaclkegviiltcgtygnvi
rllpplvisdellidglevlaaaikah

Sequence, based on observed residues (ATOM records): (download)

>d4atqh_ c.67.1.0 (H:) automated matches {Arthrobacter aurescens [TaxId: 290340]}
syrieqkrningafpgpksqalaerrsavvaagvasgvpvyvedadggiirdvdgnsfid
lgsgiavtsvgasdpavvaavqeaaahfthtcfmvtpyegyvavteqlnrltpgdhakrt
vlfnsgaeavenavkvarlatgrdavvafdhayhgrtnltmaltakampyktnfgpfape
vyrmpmsypfreenpeitgaeaakraitmiekqiggdqvaaiiiepiqgeggfivpaegf
lpalsewakekgivfiadevqsgfcrtgewfavdhegvvpdiitmakgiagglplsaitg
radlldavhpgglggtyggnpvacaaalaaidtmeqhdlngrarhieelalgklrelaas
vvgdirgrgamlaielvqpgskepnaeltkavaaaclkegviiltcgtygnvirllpplv
isdellidglevlaaaikah

SCOPe Domain Coordinates for d4atqh_:

Click to download the PDB-style file with coordinates for d4atqh_.
(The format of our PDB-style files is described here.)

Timeline for d4atqh_: