Lineage for d1dm0i_ (1dm0 I:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1787538Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1787828Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 1787829Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 1788142Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (4 species)
    phage-borne toxin; bacteriophages H30 and H19B
  7. 1788256Species Shigella dysenteriae, toxin I [TaxId:622] [50212] (3 PDB entries)
    identical sequence with verotoxin-1 B
  8. 1788279Domain d1dm0i_: 1dm0 I: [25113]
    Other proteins in same PDB: d1dm0a_, d1dm0l_

Details for d1dm0i_

PDB Entry: 1dm0 (more details), 2.5 Å

PDB Description: shiga toxin
PDB Compounds: (I:) shiga toxin b subunit

SCOPe Domain Sequences for d1dm0i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dm0i_ b.40.2.1 (I:) Verotoxin-1/shiga-toxin, B-pentamer {Shigella dysenteriae, toxin I [TaxId: 622]}
tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
ggfsevifr

SCOPe Domain Coordinates for d1dm0i_:

Click to download the PDB-style file with coordinates for d1dm0i_.
(The format of our PDB-style files is described here.)

Timeline for d1dm0i_: