Lineage for d4aryd1 (4ary D:32-255)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021035Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 3021084Superfamily f.1.3: delta-Endotoxin (insectocide), N-terminal domain [56849] (2 families) (S)
    automatically mapped to Pfam PF03945
  5. 3021108Family f.1.3.0: automated matches [254289] (1 protein)
    not a true family
  6. 3021109Protein automated matches [254672] (2 species)
    not a true protein
  7. 3021124Species Bacillus thuringiensis [TaxId:29339] [256192] (1 PDB entry)
  8. 3021128Domain d4aryd1: 4ary D:32-255 [251129]
    Other proteins in same PDB: d4arya2, d4arya3, d4aryb2, d4aryb3, d4aryc2, d4aryc3, d4aryd2, d4aryd3
    automated match to d1ciya3
    complexed with 13d, nga

Details for d4aryd1

PDB Entry: 4ary (more details), 2.95 Å

PDB Description: lepidopteran-specific toxin cry1ac in complex with receptor specificity determinant galnac
PDB Compounds: (D:) pesticidal crystal protein cry1ac

SCOPe Domain Sequences for d4aryd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4aryd1 f.1.3.0 (D:32-255) automated matches {Bacillus thuringiensis [TaxId: 29339]}
gytpidislsltqfllsefvpgagfvlglvdiiwgifgpsqwdaflvqieqlinqrieef
arnqaisrleglsnlyqiyaesfreweadptnpalreemriqfndmnsalttaiplfavq
nyqvpllsvyvqaanlhlsvlrdvsvfgqrwgfdaatinsryndltrlignytdyavrwy
ntglervwgpdsrdwvrynqfrreltltvldivalfpnydsrry

SCOPe Domain Coordinates for d4aryd1:

Click to download the PDB-style file with coordinates for d4aryd1.
(The format of our PDB-style files is described here.)

Timeline for d4aryd1: