Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
Superfamily f.1.3: delta-Endotoxin (insectocide), N-terminal domain [56849] (2 families) automatically mapped to Pfam PF03945 |
Family f.1.3.0: automated matches [254289] (1 protein) not a true family |
Protein automated matches [254672] (2 species) not a true protein |
Species Bacillus thuringiensis [TaxId:29339] [256192] (1 PDB entry) |
Domain d4aryb1: 4ary B:32-255 [251123] Other proteins in same PDB: d4arya2, d4arya3, d4aryb2, d4aryb3, d4aryc2, d4aryc3, d4aryd2, d4aryd3 automated match to d1ciya3 complexed with 13d, nga |
PDB Entry: 4ary (more details), 2.95 Å
SCOPe Domain Sequences for d4aryb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4aryb1 f.1.3.0 (B:32-255) automated matches {Bacillus thuringiensis [TaxId: 29339]} gytpidislsltqfllsefvpgagfvlglvdiiwgifgpsqwdaflvqieqlinqrieef arnqaisrleglsnlyqiyaesfreweadptnpalreemriqfndmnsalttaiplfavq nyqvpllsvyvqaanlhlsvlrdvsvfgqrwgfdaatinsryndltrlignytdyavrwy ntglervwgpdsrdwvrynqfrreltltvldivalfpnydsrry
Timeline for d4aryb1: