Lineage for d4arya3 (4ary A:463-609)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774971Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2774972Protein automated matches [190770] (51 species)
    not a true protein
  7. 2775021Species Bacillus thuringiensis [TaxId:29339] [256191] (2 PDB entries)
  8. 2775026Domain d4arya3: 4ary A:463-609 [251122]
    Other proteins in same PDB: d4arya1, d4arya2, d4aryb1, d4aryb2, d4aryc1, d4aryc2, d4aryd1, d4aryd2
    automated match to d1ciya1
    complexed with 13d, nga

Details for d4arya3

PDB Entry: 4ary (more details), 2.95 Å

PDB Description: lepidopteran-specific toxin cry1ac in complex with receptor specificity determinant galnac
PDB Compounds: (A:) pesticidal crystal protein cry1ac

SCOPe Domain Sequences for d4arya3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4arya3 b.18.1.0 (A:463-609) automated matches {Bacillus thuringiensis [TaxId: 29339]}
nniiasdsitqipavkgnflfngsvisgpgftggdlvrlnssgnniqnrgyievpihfps
tstryrvrvryasvtpihlnvnwgnssifsntvpatatsldnlqssdfgyfesanaftss
lgnivgvrnfsgtagviidrfefipvt

SCOPe Domain Coordinates for d4arya3:

Click to download the PDB-style file with coordinates for d4arya3.
(The format of our PDB-style files is described here.)

Timeline for d4arya3: