SCOPe 2.05: Domain d4arxa1: 4arx A:31-255

Lineage for d4arxa1 (4arx A:31-255)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.3: delta-Endotoxin (insectocide), N-terminal domain [56849] (2 families)
   automatically mapped to Pfam PF03945

5. Family f.1.3.1: delta-Endotoxin (insectocide), N-terminal domain [56850] (2 proteins)
   seven-helical bundle with central helix surrounded by six others

6. Protein automated matches [254738] (2 species)
   not a true protein

7. Species Bacillus thuringiensis [TaxId:29339] [256189] (1 PDB entry)

8. Domain d4arxa1: 4arx A:31-255 [251108]
   Other proteins in same PDB: d4arxa2, d4arxa3, d4arxb2, d4arxb3, d4arxc2, d4arxc3, d4arxd2, d4arxd3
   automated match to d1ciya3
   complexed with 13d, gol

Details for d4arxa1

PDB Entry: 4arx, 2.35 Å

PDB Description: lepidoptera-specific toxin cry1ac from bacillus thuringiensis ssp. kurstaki hd-73

PDB Compounds: (A:) pesticidal crystal protein cry1ac

SCOPe Domain Sequences for d4arxa1:

Sequence; same for both SEQRES and ATOM records:

>d4arxa1 f.1.3.1 (A:31-255) automated matches {Bacillus thuringiensis [TaxId: 29339]}
tgytpidislsltqfllsefvpgagfvlglvdiiwgifgpsqwdaflvqieqlinqriee
farnqaisrleglsnlyqiyaesfreweadptnpalreemriqfndmnsalttaiplfav
qnyqvpllsvyvqaanlhlsvlrdvsvfgqrwgfdaatinsryndltrlignytdyavrw
yntglervwgpdsrdwvrynqfrreltltvldivalfpnydsrry

Timeline for d4arxa1:

• d4arxa1 first appeared in SCOPe 2.04
  
• d4arxa1 appears in SCOPe 2.06
  
• d4arxa1 appears in the current release, SCOPe 2.08