SCOPe 2.04: Domain d4arvb_: 4arv B:

Lineage for d4arvb_ (4arv B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest

4. Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families)

5. Family c.60.1.0: automated matches [196988] (1 protein)
   not a true family

6. Protein automated matches [196989] (8 species)
   not a true protein

7. Species Yersinia kristensenii [TaxId:28152] [256188] (1 PDB entry)

8. Domain d4arvb_: 4arv B: [251107]
   automated match to d4arua_
   complexed with edo, p15, po4, toe

Details for d4arvb_

PDB Entry: 4arv, 1.67 Å

PDB Description: Yersinia kristensenii phytase apo form

PDB Compounds: (B:) phytase

SCOPe Domain Sequences for d4arvb_:

Sequence; same for both SEQRES and ATOM records:

>d4arvb_ c.60.1.0 (B:) automated matches {Yersinia kristensenii [TaxId: 28152]}
gytlervvilsrhgvrsptkqtqlmndvtpdkwpqwpvkagyltprgaglvtlmggfygd
yfrsygllpagcpadesiyvqadvdqrtrltgqafldgiapdcglkvhyqadlkkidplf
htveagvckldpekthqavekrlggplnelsqryakpfalmgevlnfsaspycnslqqkg
kacdfatfaaneievnkegtkvslsgplalsstlgeifllqnsqampdvawnrlsgeenw
isllslhnaqfdlmaktpyiarhkgtpllqqidtalvlqrdaqgqtlplspqtkllflgg
hdtnianiagmlganwqlpqqpdntppggglvfelwqnpdnhqryvavkmfyqtmeqlrn
adkldlknnparivpiaiegcenegdnklcqletfqkkvaqviepschi

Timeline for d4arvb_:

• d4arvb_ is new in SCOPe 2.04-stable
  
• d4arvb_ appears in SCOPe 2.05
  
• d4arvb_ appears in the current release, SCOPe 2.08