Lineage for d4arva_ (4arv A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143621Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 2143622Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. 2143852Family c.60.1.0: automated matches [196988] (1 protein)
    not a true family
  6. 2143853Protein automated matches [196989] (10 species)
    not a true protein
  7. 2143897Species Yersinia kristensenii [TaxId:28152] [256188] (1 PDB entry)
  8. 2143898Domain d4arva_: 4arv A: [251106]
    automated match to d4arua_
    complexed with edo, p15, po4, toe

Details for d4arva_

PDB Entry: 4arv (more details), 1.67 Å

PDB Description: Yersinia kristensenii phytase apo form
PDB Compounds: (A:) phytase

SCOPe Domain Sequences for d4arva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4arva_ c.60.1.0 (A:) automated matches {Yersinia kristensenii [TaxId: 28152]}
gytlervvilsrhgvrsptkqtqlmndvtpdkwpqwpvkagyltprgaglvtlmggfygd
yfrsygllpagcpadesiyvqadvdqrtrltgqafldgiapdcglkvhyqadlkkidplf
htveagvckldpekthqavekrlggplnelsqryakpfalmgevlnfsaspycnslqqkg
kacdfatfaaneievnkegtkvslsgplalsstlgeifllqnsqampdvawnrlsgeenw
isllslhnaqfdlmaktpyiarhkgtpllqqidtalvlqrdaqgqtlplspqtkllflgg
hdtnianiagmlganwqlpqqpdntppggglvfelwqnpdnhqryvavkmfyqtmeqlrn
adkldlknnparivpiaiegcenegdnklcqletfqkkvaqviepschi

SCOPe Domain Coordinates for d4arva_:

Click to download the PDB-style file with coordinates for d4arva_.
(The format of our PDB-style files is described here.)

Timeline for d4arva_: