Lineage for d4apya_ (4apy A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005722Species Mycobacterium smegmatis [TaxId:1772] [256187] (1 PDB entry)
  8. 2005723Domain d4apya_: 4apy A: [251105]
    automated match to d2xc3a_
    complexed with cl, edo, hem

Details for d4apya_

PDB Entry: 4apy (more details), 2 Å

PDB Description: Ethylene glycol-bound form of P450 CYP125A3 from Mycobacterium smegmatis
PDB Compounds: (A:) p450 heme-thiolate protein

SCOPe Domain Sequences for d4apya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4apya_ a.104.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 1772]}
ptpnipsdfdfldatlnlerlpveelaelrksepihwvdvpggtggfgdkgywlvtkhad
vkevsrrsdvfgsspdgaipvwpqdmtreavdlqravllnmdapqhtrlrkiisrgftpr
aigrledelrsraqkiaqtaaaqgagdfveqvscelplqaiaellgvpqddrdklfrwsn
emtagedpeyadvdpamssfelisyamkmaeeravnptedivtklieadidgeklsddef
gffvvmlavagnettrnsithgmiafaqnpdqwelykkerpetaadeivrwatpvsafqr
taledvelggvqikkgqrvvmsyrsanfdeevfedphtfnilrspnphvgfggtgahyci
ganlarmtinlifnaiadnmpdlkpigaperlksgwlngikhwqvdytgagkas

SCOPe Domain Coordinates for d4apya_:

Click to download the PDB-style file with coordinates for d4apya_.
(The format of our PDB-style files is described here.)

Timeline for d4apya_: