![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (15 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries) |
![]() | Domain d4apqc2: 4apq C:120-206 [251102] Other proteins in same PDB: d4apqa1, d4apqa2, d4apqa3, d4apqb_, d4apqc1, d4apqd1, d4apqd2 automated match to d4eura2 complexed with cis |
PDB Entry: 4apq (more details), 3 Å
SCOPe Domain Sequences for d4apqc2:
Sequence, based on SEQRES records: (download)
>d4apqc2 b.1.1.2 (C:120-206) automated matches {Mouse (Mus musculus) [TaxId: 10090]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsnksdfacanafnnsiipedtff
>d4apqc2 b.1.1.2 (C:120-206) automated matches {Mouse (Mus musculus) [TaxId: 10090]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsacanafnnsiipedtff
Timeline for d4apqc2: