Lineage for d4apqc1 (4apq C:1-119)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760909Domain d4apqc1: 4apq C:1-119 [251101]
    Other proteins in same PDB: d4apqa1, d4apqa3, d4apqb_, d4apqc2
    automated match to d4eura1
    complexed with cis

Details for d4apqc1

PDB Entry: 4apq (more details), 3 Å

PDB Description: crystal structure of autoreactive-valpha14-vbeta6 nkt tcr in complex with cd1d-sulfatide
PDB Compounds: (C:) mouse nkt tcr valpha14, human nkt tcr valpha14

SCOPe Domain Sequences for d4apqc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4apqc1 b.1.1.0 (C:1-119) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tqveqspqslvvrqgensvlqcnysvtpdnhlrwfkqdtgkglvsltvlvdqkdktsngr
ysatldkdakhstlhitatllddtatyicvvgdrgsalgrlhfgagtqlivipd

SCOPe Domain Coordinates for d4apqc1:

Click to download the PDB-style file with coordinates for d4apqc1.
(The format of our PDB-style files is described here.)

Timeline for d4apqc1: