Lineage for d4ap2b_ (4ap2 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2007926Superfamily a.118.17: Cullin repeat-like [74788] (3 families) (S)
  5. 2007947Family a.118.17.0: automated matches [196491] (1 protein)
    not a true family
  6. 2007948Protein automated matches [196508] (2 species)
    not a true protein
  7. 2007949Species Human (Homo sapiens) [TaxId:9606] [256186] (4 PDB entries)
  8. 2007954Domain d4ap2b_: 4ap2 B: [251095]
    automated match to d1ldka_
    complexed with cl, edo, iod

Details for d4ap2b_

PDB Entry: 4ap2 (more details), 2.8 Å

PDB Description: Crystal structure of the human KLHL11-Cul3 complex at 2.8A resolution
PDB Compounds: (B:) cullin-3

SCOPe Domain Sequences for d4ap2b_:

Sequence, based on SEQRES records: (download)

>d4ap2b_ a.118.17.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rirafpmtmdekyvnsiwdllknaiqeiqrknnsglsfeelyrnaytmvlhkhgeklytg
lrevvtehlinkvredvlnslnnnflqtlnqawndhqtamvmirdilmymdrvyvqqnnv
envynlgliifrdqvvrygcirdhlrqtlldmiarerkgevvdrgairnacqmlmilgle
grsvyeedfeapflemsaeffqmesqkflaensasvyikkvearineeiervmhcldkst
eepivkvvereliskhmktivemensglvhmlkngktedlgcmyklfsrvpnglktmcec
mssylreqgkalvseegegknpvdyrqglddlksrfdrfllesfnndrlfkqtiagdfey
flnln

Sequence, based on observed residues (ATOM records): (download)

>d4ap2b_ a.118.17.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rirafpmtmdekyvnsiwdllknaiqeiqrknnsglsfeelyrnaytmvlhkhgeklytg
lrevvtehlinkvredvlnslnnnflqtlnqawndhqtamvmirdilmymdrvyvqqnnv
envynlgliifrdqvvrygcirdhlrqtlldmiarerkgevvdrgairnacqmlmilgle
grsvyeedfeapflemsaeffqmesqkflaensasvyikkvearineeiervmhcldkst
eepivkvvereliskhmktivemensglvhmlkngktedlgcmyklfsrvpnglktmcec
mssylreqgkalvsepvdyrqglddlksrfdrfllesfnndrlfkqtiagdfeyflnln

SCOPe Domain Coordinates for d4ap2b_:

Click to download the PDB-style file with coordinates for d4ap2b_.
(The format of our PDB-style files is described here.)

Timeline for d4ap2b_: