Lineage for d4anxa3 (4anx A:544-725)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2338495Superfamily a.118.1: ARM repeat [48371] (27 families) (S)
  5. 2339141Family a.118.1.0: automated matches [191340] (1 protein)
    not a true family
  6. 2339142Protein automated matches [190220] (14 species)
    not a true protein
  7. 2339168Species Human (Homo sapiens) [TaxId:9606] [189070] (63 PDB entries)
  8. 2339204Domain d4anxa3: 4anx A:544-725 [251093]
    Other proteins in same PDB: d4anxa1, d4anxa2, d4anxa4, d4anxa5
    automated match to d1e7ua1
    complexed with 534

Details for d4anxa3

PDB Entry: 4anx (more details), 2.73 Å

PDB Description: complexes of pi3kgamma with isoform selective inhibitors.
PDB Compounds: (A:) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d4anxa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4anxa3 a.118.1.0 (A:544-725) automated matches {Human (Homo sapiens) [TaxId: 9606]}
raempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwgqqei
vaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhyllql
vqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavileaylrg
cg

SCOPe Domain Coordinates for d4anxa3:

Click to download the PDB-style file with coordinates for d4anxa3.
(The format of our PDB-style files is described here.)

Timeline for d4anxa3: