Lineage for d4anxa1 (4anx A:144-321)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2933104Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2933105Protein automated matches [190233] (31 species)
    not a true protein
  7. 2933161Species Human (Homo sapiens) [TaxId:9606] [187090] (156 PDB entries)
  8. 2933361Domain d4anxa1: 4anx A:144-321 [251091]
    Other proteins in same PDB: d4anxa2, d4anxa3, d4anxa4, d4anxa5
    automated match to d1e7ua3
    complexed with 534

Details for d4anxa1

PDB Entry: 4anx (more details), 2.73 Å

PDB Description: complexes of pi3kgamma with isoform selective inhibitors.
PDB Compounds: (A:) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d4anxa1:

Sequence, based on SEQRES records: (download)

>d4anxa1 d.15.1.0 (A:144-321) automated matches {Human (Homo sapiens) [TaxId: 9606]}
seesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvt
skplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkkslmdipe
sqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrke

Sequence, based on observed residues (ATOM records): (download)

>d4anxa1 d.15.1.0 (A:144-321) automated matches {Human (Homo sapiens) [TaxId: 9606]}
seesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvt
skplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmeqdfvlrvcgr
deylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrke

SCOPe Domain Coordinates for d4anxa1:

Click to download the PDB-style file with coordinates for d4anxa1.
(The format of our PDB-style files is described here.)

Timeline for d4anxa1: