SCOPe 2.05: Domain d4anva1: 4anv A:144-321

Lineage for d4anva1 (4anv A:144-321)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (9 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187090] (45 PDB entries)

8. Domain d4anva1: 4anv A:144-321 [251083]
   Other proteins in same PDB: d4anva2, d4anva3, d4anva4
   automated match to d1e7ua3
   complexed with 751, so4

Details for d4anva1

PDB Entry: 4anv, 2.13 Å

PDB Description: Complexes of PI3Kgamma with isoform selective inhibitors.

PDB Compounds: (A:) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d4anva1:

Sequence, based on SEQRES records:

>d4anva1 d.15.1.0 (A:144-321) automated matches {Human (Homo sapiens) [TaxId: 9606]}
seesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvt
skplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkkslmdipe
sqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrke

Sequence, based on observed residues (ATOM records):

>d4anva1 d.15.1.0 (A:144-321) automated matches {Human (Homo sapiens) [TaxId: 9606]}
seesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvt
skplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmeqdfvlrvcgr
deylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrke

Timeline for d4anva1:

• d4anva1 first appeared in SCOPe 2.04
  
• d4anva1 appears in SCOPe 2.06
  
• d4anva1 appears in the current release, SCOPe 2.08