Class a: All alpha proteins [46456] (286 folds) |
Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.1: ARM repeat [48371] (26 families) |
Family a.118.1.0: automated matches [191340] (1 protein) not a true family |
Protein automated matches [190220] (12 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189070] (29 PDB entries) |
Domain d4anua3: 4anu A:544-725 [251081] Other proteins in same PDB: d4anua1, d4anua2, d4anua4 automated match to d1e7ua1 complexed with em7, so4 |
PDB Entry: 4anu (more details), 2.81 Å
SCOPe Domain Sequences for d4anua3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4anua3 a.118.1.0 (A:544-725) automated matches {Human (Homo sapiens) [TaxId: 9606]} raempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwgqqei vaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhyllql vqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavileaylrg cg
Timeline for d4anua3: