Lineage for d4anua1 (4anu A:143-321)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1892545Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1893753Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 1893754Protein automated matches [190233] (11 species)
    not a true protein
  7. 1893780Species Human (Homo sapiens) [TaxId:9606] [187090] (45 PDB entries)
  8. 1893829Domain d4anua1: 4anu A:143-321 [251079]
    Other proteins in same PDB: d4anua2, d4anua3, d4anua4
    automated match to d1e7ua3
    complexed with em7, so4

Details for d4anua1

PDB Entry: 4anu (more details), 2.81 Å

PDB Description: Complexes of PI3Kgamma with isoform selective inhibitors.
PDB Compounds: (A:) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d4anua1:

Sequence, based on SEQRES records: (download)

>d4anua1 d.15.1.0 (A:143-321) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sseesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwv
tskplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkkslmdip
esqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrke

Sequence, based on observed residues (ATOM records): (download)

>d4anua1 d.15.1.0 (A:143-321) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sseesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwv
tskplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmeqdfvlrvcg
rdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrke

SCOPe Domain Coordinates for d4anua1:

Click to download the PDB-style file with coordinates for d4anua1.
(The format of our PDB-style files is described here.)

Timeline for d4anua1: