Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
Protein automated matches [190226] (81 species) not a true protein |
Species Dengue virus [TaxId:11070] [256185] (1 PDB entry) |
Domain d4am0q_: 4am0 Q: [251075] Other proteins in same PDB: d4am0a_, d4am0b1, d4am0b2, d4am0c_, d4am0d1, d4am0d2, d4am0e_, d4am0f1, d4am0f2, d4am0h_, d4am0l1, d4am0l2 automated match to d1pjwa_ |
PDB Entry: 4am0 (more details), 3.02 Å
SCOPe Domain Sequences for d4am0q_:
Sequence, based on SEQRES records: (download)
>d4am0q_ b.1.18.0 (Q:) automated matches {Dengue virus [TaxId: 11070]} tmcsgkfsidkemaetqhgttvvkvkyegagapckvpieirdvnkekvvgriisstpfae ytnsvtnieleppfgdsyivigvgdsaltlhwfr
>d4am0q_ b.1.18.0 (Q:) automated matches {Dengue virus [TaxId: 11070]} tmcsgkfsidkemaetqhgttvvkvkyegagapckvpieirdvnvvgriisstpfaeytn svtnieleppfgdsyivigvgdsaltlhwfr
Timeline for d4am0q_: