SCOPe 2.08: Domain d4am0l2: 4am0 L:108-212

Lineage for d4am0l2 (4am0 L:108-212)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d4am0l2: 4am0 L:108-212 [251074]
   Other proteins in same PDB: d4am0a_, d4am0b1, d4am0c_, d4am0d1, d4am0e_, d4am0f1, d4am0h_, d4am0l1, d4am0q_, d4am0r_, d4am0s_, d4am0t_
   automated match to d12e8l2

Details for d4am0l2

PDB Entry: 4am0, 3.02 Å

PDB Description: structure of dengue virus strain 4 diii in complex with fab 2h12

PDB Compounds: (L:) fab 2h12, light chain

SCOPe Domain Sequences for d4am0l2:

Sequence; same for both SEQRES and ATOM records:

>d4am0l2 b.1.1.2 (L:108-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

Timeline for d4am0l2:

• d4am0l2 first appeared in SCOPe 2.04
  
• d4am0l2 appears in SCOPe 2.07