| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (15 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries) |
| Domain d4am0l2: 4am0 L:108-212 [251074] Other proteins in same PDB: d4am0a_, d4am0b1, d4am0c_, d4am0d1, d4am0e_, d4am0f1, d4am0h_, d4am0l1, d4am0q_, d4am0r_, d4am0s_, d4am0t_ automated match to d12e8l2 |
PDB Entry: 4am0 (more details), 3.02 Å
SCOPe Domain Sequences for d4am0l2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4am0l2 b.1.1.2 (L:108-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn
Timeline for d4am0l2: