SCOPe 2.04: Domain d4am0b2: 4am0 B:108-212

Lineage for d4am0b2 (4am0 B:108-212)

Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (9 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries)
Domain d4am0b2: 4am0 B:108-212 [251068]
Other proteins in same PDB: d4am0b1, d4am0d1, d4am0f1, d4am0l1, d4am0q_, d4am0r_, d4am0s_, d4am0t_
automated match to d12e8l2

Details for d4am0b2

PDB Entry: 4am0 (more details), 3.02 Å

PDB Description: structure of dengue virus strain 4 diii in complex with fab 2h12

PDB Compounds: (B:) fab 2h12, light chain

SCOPe Domain Sequences for d4am0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4am0b2 b.1.1.2 (B:108-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOPe Domain Coordinates for d4am0b2:

Click to download the PDB-style file with coordinates for d4am0b2.
(The format of our PDB-style files is described here.)

Timeline for d4am0b2: