| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein automated matches [190119] (24 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries) |
| Domain d4am0b1: 4am0 B:1-107 [251067] Other proteins in same PDB: d4am0b2, d4am0d2, d4am0f2, d4am0l2, d4am0q_, d4am0r_, d4am0s_, d4am0t_ automated match to d12e8l1 |
PDB Entry: 4am0 (more details), 3.02 Å
SCOPe Domain Sequences for d4am0b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4am0b1 b.1.1.1 (B:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmtqsqkfmstsvgdrvsitckasqnvrtsvawyqqkpgqspkaliylasnrhtgvpd
rftgsgsgtdftltisnvqsedladyfclqhwtypytfgggtkleik
Timeline for d4am0b1: