Lineage for d4albb_ (4alb B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2071989Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2071990Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2073033Family b.60.1.6: Phenolic acid decarboxylase (PAD) [141469] (2 proteins)
    Pfam PF05870; dimeric enzyme made of lipocalin-like subunits
  6. 2073040Protein automated matches [226940] (3 species)
    not a true protein
  7. 2073044Species Bacillus subtilis [TaxId:1423] [225256] (2 PDB entries)
  8. 2073047Domain d4albb_: 4alb B: [251062]
    automated match to d2p8ga_
    complexed with hc4; mutant

Details for d4albb_

PDB Entry: 4alb (more details), 3.03 Å

PDB Description: Structure of Phenolic Acid Decarboxylase from Bacillus subtilis: Tyr19Ala mutant in complex with coumaric acid
PDB Compounds: (B:) phenolic acid decarboxylase padc

SCOPe Domain Sequences for d4albb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4albb_ b.60.1.6 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
enfigshmiytyengweaeiyikndhtidyrihsgmvagrwvrdqevnivkltegvykvs
wteptgtdvslnfmpnekrmhgiiffpkwvhehpeitvcyqndhidlmkesrekyetypk
yvvpefaeitflknegvdneeviskapyegmtddiragr

SCOPe Domain Coordinates for d4albb_:

Click to download the PDB-style file with coordinates for d4albb_.
(The format of our PDB-style files is described here.)

Timeline for d4albb_: