Class b: All beta proteins [48724] (177 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.6: Phenolic acid decarboxylase (PAD) [141469] (2 proteins) Pfam PF05870; dimeric enzyme made of lipocalin-like subunits |
Protein automated matches [226940] (3 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [225256] (2 PDB entries) |
Domain d4albb_: 4alb B: [251062] automated match to d2p8ga_ complexed with hc4; mutant |
PDB Entry: 4alb (more details), 3.03 Å
SCOPe Domain Sequences for d4albb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4albb_ b.60.1.6 (B:) automated matches {Bacillus subtilis [TaxId: 1423]} enfigshmiytyengweaeiyikndhtidyrihsgmvagrwvrdqevnivkltegvykvs wteptgtdvslnfmpnekrmhgiiffpkwvhehpeitvcyqndhidlmkesrekyetypk yvvpefaeitflknegvdneeviskapyegmtddiragr
Timeline for d4albb_: