Lineage for d4akqa3 (4akq A:357-511)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2772201Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2772202Protein automated matches [190824] (31 species)
    not a true protein
  7. 2772327Species Bacillus subtilis [TaxId:1423] [255666] (7 PDB entries)
  8. 2772345Domain d4akqa3: 4akq A:357-511 [251060]
    automated match to d1gska3
    complexed with cu, edo, oxy; mutant

Details for d4akqa3

PDB Entry: 4akq (more details), 2.1 Å

PDB Description: Mutations in the neighbourhood of CotA-laccase trinuclear site: E498D mutant
PDB Compounds: (A:) spore coat protein

SCOPe Domain Sequences for d4akqa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4akqa3 b.6.1.0 (A:357-511) automated matches {Bacillus subtilis [TaxId: 1423]}
sypsvqheriqnirtlklagtqdeygrpvlllnnkrwhdpvtetpkvgtteiwsiinptr
gthpihlhlvsfrvldrrpfdiaryqesgelsytgpavppppsekgwkdtiqahagevlr
iaatfgpysgryvwhchilehddydmmrpmditdp

SCOPe Domain Coordinates for d4akqa3:

Click to download the PDB-style file with coordinates for d4akqa3.
(The format of our PDB-style files is described here.)

Timeline for d4akqa3: