Lineage for d1dm0b_ (1dm0 B:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 373898Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 373966Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 373967Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 374244Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (3 species)
    phage-borne toxin; bacteriophages H30 and H19B
  7. 374337Species Shigella dysenteriae, toxin I [TaxId:622] [50212] (3 PDB entries)
    identical sequence with verotoxin-1 B
  8. 374353Domain d1dm0b_: 1dm0 B: [25106]
    Other proteins in same PDB: d1dm0a_, d1dm0l_

Details for d1dm0b_

PDB Entry: 1dm0 (more details), 2.5 Å

PDB Description: shiga toxin

SCOP Domain Sequences for d1dm0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dm0b_ b.40.2.1 (B:) Verotoxin-1/shiga-toxin, B-pentamer {Shigella dysenteriae, toxin I}
tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
ggfsevifr

SCOP Domain Coordinates for d1dm0b_:

Click to download the PDB-style file with coordinates for d1dm0b_.
(The format of our PDB-style files is described here.)

Timeline for d1dm0b_: