![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
![]() | Protein automated matches [190824] (31 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:1423] [255666] (7 PDB entries) |
![]() | Domain d4akoa1: 4ako A:2-182 [251052] automated match to d1gska1 complexed with cu, edo, oxy; mutant |
PDB Entry: 4ako (more details), 1.7 Å
SCOPe Domain Sequences for d4akoa1:
Sequence, based on SEQRES records: (download)
>d4akoa1 b.6.1.0 (A:2-182) automated matches {Bacillus subtilis [TaxId: 1423]} tlekfvdalpipdtlkpvqqskektyyevtmeecthqlhrdlpptrlwgynglfpgptie vkrnenvyvkwmnnlpsthflpidhtihhsdsqheepevktvvhlhggvtpddsdgypea wfskdfeqtgpyfkrevyhypnqqrgailwyhdhamaltrlnvyaglvgayiihdpkekr l
>d4akoa1 b.6.1.0 (A:2-182) automated matches {Bacillus subtilis [TaxId: 1423]} tlekfvdalpipdtlkpvqqskektyyevtmeecthqlhrdlpptrlwgynglfpgptie vkrnenvyvkwmnnlpsthflpidhtihhseepevktvvhlhggvtpddsdgypeawfsk dfeqtgpyfkrevyhypnqqrgailwyhdhamaltrlnvyaglvgayiihdpkekrl
Timeline for d4akoa1: