Class b: All beta proteins [48724] (176 folds) |
Fold b.180: Pseudo beta-prism II [254120] (1 superfamily) sandwich with one 5-strand antiparallel beta-sheet and a 5-strand mixed beta-sheet bent in the middle with a set of aligned beta-bulges and/or strand breaks; disulfide linked |
Superfamily b.180.1: LAMP conserved domain-like [254145] (1 family) Pfam PF01299, PubMed 22809326 |
Family b.180.1.1: LAMP conserved domain [254192] (1 protein) |
Protein DC-LAMP [254421] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [254864] (1 PDB entry) |
Domain d4akma_: 4akm A: [251050] complexed with ir3, nag |
PDB Entry: 4akm (more details), 2.69 Å
SCOPe Domain Sequences for d4akma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4akma_ b.180.1.1 (A:) DC-LAMP {Human (Homo sapiens) [TaxId: 9606]} vktgiyqvlngsrlcikaemgiqlivqdkesvfsprryfnidpnatqasgncgtrksnll lnfqggfvnltftkdeesyyisevgayltvsdpetvyqgikhavvmfqtavghsfkcvse qslqlsahlqvkttdvqlqafdfeddhfgnvdecs
Timeline for d4akma_: