SCOPe 2.04: Domain d4akma_: 4akm A:

Lineage for d4akma_ (4akm A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.180: Pseudo beta-prism II [254120] (1 superfamily)
   sandwich with one 5-strand antiparallel beta-sheet and a 5-strand mixed beta-sheet bent in the middle with a set of aligned beta-bulges and/or strand breaks; disulfide linked

4. Superfamily b.180.1: LAMP conserved domain-like [254145] (1 family)
   Pfam PF01299, PubMed 22809326

5. Family b.180.1.1: LAMP conserved domain [254192] (1 protein)

6. Protein DC-LAMP [254421] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [254864] (1 PDB entry)

8. Domain d4akma_: 4akm A: [251050]
   complexed with ir3, nag

Details for d4akma_

PDB Entry: 4akm, 2.69 Å

PDB Description: crystal structure of the human lysosome-associated membrane protein lamp-3 (aka dc-lamp)

PDB Compounds: (A:) lysosome-associated membrane glycoprotein 3

SCOPe Domain Sequences for d4akma_:

Sequence; same for both SEQRES and ATOM records:

>d4akma_ b.180.1.1 (A:) DC-LAMP {Human (Homo sapiens) [TaxId: 9606]}
vktgiyqvlngsrlcikaemgiqlivqdkesvfsprryfnidpnatqasgncgtrksnll
lnfqggfvnltftkdeesyyisevgayltvsdpetvyqgikhavvmfqtavghsfkcvse
qslqlsahlqvkttdvqlqafdfeddhfgnvdecs

Timeline for d4akma_:

• d4akma_ is new in SCOPe 2.04-stable
  
• d4akma_ appears in SCOPe 2.05
  
• d4akma_ appears in the current release, SCOPe 2.08