Class a: All alpha proteins [46456] (289 folds) |
Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) |
Family a.211.1.0: automated matches [191566] (1 protein) not a true family |
Protein automated matches [190983] (9 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188676] (111 PDB entries) |
Domain d4ajma1: 4ajm A:449-766 [251048] Other proteins in same PDB: d4ajma2 automated match to d4ajda_ complexed with 3a6, mg, zn |
PDB Entry: 4ajm (more details), 2.4 Å
SCOPe Domain Sequences for d4ajma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ajma1 a.211.1.0 (A:449-766) automated matches {Human (Homo sapiens) [TaxId: 9606]} sictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfelekl crfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhr gfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirk aiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtklt andiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilppt epllkacrdnlsqwekvi
Timeline for d4ajma1: