SCOPe 2.04: Domain d4ajma_: 4ajm A:

Lineage for d4ajma_ (4ajm A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188676] (56 PDB entries)

8. Domain d4ajma_: 4ajm A: [251048]
   automated match to d4ajda_
   complexed with 3a6, mg, zn

Details for d4ajma_

PDB Entry: 4ajm, 2.4 Å

PDB Description: Development of a plate-based optical biosensor methodology to identify PDE10 fragment inhibitors

PDB Compounds: (A:) camp and camp-inhibited cgmp 3', 5'-cyclic phosphodiesterase 10a

SCOPe Domain Sequences for d4ajma_:

Sequence; same for both SEQRES and ATOM records:

>d4ajma_ a.211.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nasictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfele
klcrfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdld
hrgfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleii
rkaiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtk
ltandiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilp
ptepllkacrdnlsqwekvi

Timeline for d4ajma_:

• d4ajma_ is new in SCOPe 2.04-stable
  
• d4ajma_ appears in SCOPe 2.05
  
• d4ajma_ appears in the current release, SCOPe 2.08, called d4ajma1