SCOPe 2.05: Domain d4ajgd_: 4ajg D:

Lineage for d4ajgd_ (4ajg D:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188676] (86 PDB entries)

8. Domain d4ajgd_: 4ajg D: [251047]
   automated match to d4ajda_
   complexed with f07, mg, zn

Details for d4ajgd_

PDB Entry: 4ajg, 2.3 Å

PDB Description: Identification and structural characterization of PDE10 fragment inhibitors

PDB Compounds: (D:) camp and camp-inhibited cgmp 3', 5'-cyclic phosphodiesterase 10a

SCOPe Domain Sequences for d4ajgd_:

Sequence; same for both SEQRES and ATOM records:

>d4ajgd_ a.211.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
asictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfelek
lcrfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldh
rgfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiir
kaiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkl
tandiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpp
tepllkacrdnlsqwekvirge

Timeline for d4ajgd_:

• d4ajgd_ first appeared in SCOPe 2.04
  
• d4ajgd_ is called d4ajgd1 in SCOPe 2.06
  
• d4ajgd_ appears in the current release, SCOPe 2.08, called d4ajgd1