SCOPe 2.08: Domain d4ajga1: 4ajg A:449-768

Lineage for d4ajga1 (4ajg A:449-768)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188676] (139 PDB entries)

8. Domain d4ajga1: 4ajg A:449-768 [251046]
   Other proteins in same PDB: d4ajga2, d4ajgd2
   automated match to d4ajda_
   complexed with f07, mg, zn

Details for d4ajga1

PDB Entry: 4ajg, 2.3 Å

PDB Description: Identification and structural characterization of PDE10 fragment inhibitors

PDB Compounds: (A:) camp and camp-inhibited cgmp 3', 5'-cyclic phosphodiesterase 10a

SCOPe Domain Sequences for d4ajga1:

Sequence; same for both SEQRES and ATOM records:

>d4ajga1 a.211.1.0 (A:449-768) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfelekl
crfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhr
gfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirk
aiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtklt
andiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilppt
epllkacrdnlsqwekvirg

Timeline for d4ajga1:

• d4ajga1 first appeared in SCOPe 2.04, called d4ajga_
  
• d4ajga1 appears in SCOPe 2.07