Class a: All alpha proteins [46456] (290 folds) |
Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) |
Family a.211.1.0: automated matches [191566] (1 protein) not a true family |
Protein automated matches [190983] (12 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188676] (139 PDB entries) |
Domain d4ajfd1: 4ajf D:449-770 [251045] Other proteins in same PDB: d4ajfa2, d4ajfd2 automated match to d4ajda_ complexed with f03, mg, zn |
PDB Entry: 4ajf (more details), 1.9 Å
SCOPe Domain Sequences for d4ajfd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ajfd1 a.211.1.0 (D:449-770) automated matches {Human (Homo sapiens) [TaxId: 9606]} sictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfelekl crfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhr gfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirk aiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtklt andiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilppt epllkacrdnlsqwekvirgee
Timeline for d4ajfd1: