SCOPe 2.04: Domain d4ajfa_: 4ajf A:

Lineage for d4ajfa_ (4ajf A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188676] (56 PDB entries)

8. Domain d4ajfa_: 4ajf A: [251044]
   automated match to d4ajda_
   complexed with f03, mg, zn

Details for d4ajfa_

PDB Entry: 4ajf, 1.9 Å

PDB Description: identification and structural characterization of pde10 fragment inhibitors

PDB Compounds: (A:) camp and camp-inhibited cgmp 3', 5'-cyclic phosphodiesterase 10a

SCOPe Domain Sequences for d4ajfa_:

Sequence; same for both SEQRES and ATOM records:

>d4ajfa_ a.211.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nasictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfele
klcrfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdld
hrgfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleii
rkaiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtk
ltandiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilp
ptepllkacrdnlsqwekvirgeetatw

Timeline for d4ajfa_:

• d4ajfa_ is new in SCOPe 2.04-stable
  
• d4ajfa_ appears in SCOPe 2.05
  
• d4ajfa_ appears in the current release, SCOPe 2.08, called d4ajfa1