SCOPe 2.04: Domain d4aiua2: 4aiu A:127-436

Lineage for d4aiua2 (4aiu A:127-436)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.10: alpha-D-glucuronidase/Hyaluronidase catalytic domain [82253] (4 proteins)
   Glycosyl hydrolase family 67, GH67; structurally related to GH20; contains extra C-terminal alpha-helical subdomain

6. Protein automated matches [254553] (2 species)
   not a true protein
7. Species Bacteroides thetaiotaomicron [TaxId:226186] [255268] (4 PDB entries)

8. Domain d4aiua2: 4aiu A:127-436 [251042]
   Other proteins in same PDB: d4aiua1, d4aiua3
   automated match to d2choa2
   complexed with ca, gc3

Details for d4aiua2

PDB Entry: 4aiu, 2.25 Å

PDB Description: A complex structure of BtGH84

PDB Compounds: (A:) o-glcnacase bt_4395

SCOPe Domain Sequences for d4aiua2:

Sequence; same for both SEQRES and ATOM records:

>d4aiua2 c.1.8.10 (A:127-436) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
vryrgvvegfygtpwshqarlsqlkfygknkmntyiygpkddpyhsapnwrlpypdkeaa
qlqelvavanenevdfvwaihpgqdikwnkedrdlllakfekmyqlgvrsfavffndisg
egtnpqkqaellnyidekfaqvkpdinqlvmcpteynkswsnpngnylttlgdklnpsiq
imwtgdrvisditrdgiswinerikrpayiwwnfpvsdyvrdhlllgpvygndttiakem
sgfvtnpmehaesskiaiysvasyawnpakydtwqtwkdairtilpsaaeelecfamhns
dlgpnghgyr

Timeline for d4aiua2:

• d4aiua2 is new in SCOPe 2.04-stable
  
• d4aiua2 appears in SCOPe 2.05
  
• d4aiua2 appears in the current release, SCOPe 2.08