Class b: All beta proteins [48724] (176 folds) |
Fold b.179: Anthrax protective antigen N-terminal-like [254104] (1 superfamily) core: sandwich; 10-12 strands in 2 sheets; jelly roll; may contain inserted subdomains |
Superfamily b.179.1: PA14-like [254123] (3 families) |
Family b.179.1.2: GLEYA domain [254187] (2 proteins) Pfam PF10528 PubMed 21149680; inserted Flo5 subdomain (84-120) contains 5 short beta strands and two disulfide bridges |
Protein automated matches [254737] (2 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256184] (10 PDB entries) |
Domain d4ai1a_: 4ai1 A: [251036] automated match to d2xjra_ complexed with cl, gd, gol |
PDB Entry: 4ai1 (more details), 1.8 Å
SCOPe Domain Sequences for d4ai1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ai1a_ b.179.1.2 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} glvprgshmsgateaclpagqrksgmninfyqyslkdsstysnaaymaygyasktklgsv ggqtdisidynipcvsssgtfpcpqedsygnwgckgmgacsnsqgiaywstdlfgfyttp tnvtlemtgyflppqtgsytfsfatvddsailsvggsiafeccaqeqppitstnftingi kpwdgslpdnitgtvymyagyyyplkvvysnavswgtlpisvelpdgttvsdnfegyvys fdddlsqsnctipdpsih
Timeline for d4ai1a_: