SCOPe 2.05: Domain d4ai1a_: 4ai1 A:

Lineage for d4ai1a_ (4ai1 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.179: Anthrax protective antigen N-terminal-like [254104] (1 superfamily)
   core: sandwich; 10-12 strands in 2 sheets; jelly roll; may contain inserted subdomains

4. Superfamily b.179.1: PA14-like [254123] (3 families)

5. Family b.179.1.2: GLEYA domain [254187] (2 proteins)
   Pfam PF10528
   PubMed 21149680; inserted Flo5 subdomain (84-120) contains 5 short beta strands and two disulfide bridges

6. Protein automated matches [254737] (2 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256184] (10 PDB entries)

8. Domain d4ai1a_: 4ai1 A: [251036]
   automated match to d2xjra_
   complexed with cl, gd, gol

Details for d4ai1a_

PDB Entry: 4ai1, 1.8 Å

PDB Description: Flo5A showing a heptanuclear gadolinium cluster on its surface after 19 min of soaking

PDB Compounds: (A:) flocculation protein flo5

SCOPe Domain Sequences for d4ai1a_:

Sequence; same for both SEQRES and ATOM records:

>d4ai1a_ b.179.1.2 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
glvprgshmsgateaclpagqrksgmninfyqyslkdsstysnaaymaygyasktklgsv
ggqtdisidynipcvsssgtfpcpqedsygnwgckgmgacsnsqgiaywstdlfgfyttp
tnvtlemtgyflppqtgsytfsfatvddsailsvggsiafeccaqeqppitstnftingi
kpwdgslpdnitgtvymyagyyyplkvvysnavswgtlpisvelpdgttvsdnfegyvys
fdddlsqsnctipdpsih

Timeline for d4ai1a_:

• d4ai1a_ first appeared in SCOPe 2.04
  
• d4ai1a_ is called d4ai1a1 in SCOPe 2.06
  
• d4ai1a_ appears in the current release, SCOPe 2.08, called d4ai1a1