Lineage for d4ai0a1 (4ai0 A:23-271)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2825681Fold b.179: Anthrax protective antigen N-terminal-like [254104] (1 superfamily)
    core: sandwich; 10-12 strands in 2 sheets; jelly roll; may contain inserted subdomains
  4. 2825682Superfamily b.179.1: PA14-like [254123] (4 families) (S)
  5. 2825724Family b.179.1.2: GLEYA domain [254187] (2 proteins)
    Pfam PF10528
    PubMed 21149680; inserted Flo5 subdomain (84-120) contains 5 short beta strands and two disulfide bridges
  6. 2825734Protein automated matches [254737] (2 species)
    not a true protein
  7. 2825735Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256184] (10 PDB entries)
  8. 2825739Domain d4ai0a1: 4ai0 A:23-271 [251035]
    Other proteins in same PDB: d4ai0a2
    automated match to d2xjra_
    complexed with cl, gd

Details for d4ai0a1

PDB Entry: 4ai0 (more details), 1.8 Å

PDB Description: Flo5A showing a heptanuclear gadolinium cluster on its surface after 9 min of soaking
PDB Compounds: (A:) flocculation protein flo5

SCOPe Domain Sequences for d4ai0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ai0a1 b.179.1.2 (A:23-271) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
sgateaclpagqrksgmninfyqyslkdsstysnaaymaygyasktklgsvggqtdisid
ynipcvsssgtfpcpqedsygnwgckgmgacsnsqgiaywstdlfgfyttptnvtlemtg
yflppqtgsytfsfatvddsailsvggsiafeccaqeqppitstnftingikpwdgslpd
nitgtvymyagyyyplkvvysnavswgtlpisvelpdgttvsdnfegyvysfdddlsqsn
ctipdpsih

SCOPe Domain Coordinates for d4ai0a1:

Click to download the PDB-style file with coordinates for d4ai0a1.
(The format of our PDB-style files is described here.)

Timeline for d4ai0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ai0a2