Lineage for d4ahza_ (4ahz A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1815211Fold b.179: Anthrax protective antigen N-terminal-like [254104] (1 superfamily)
    core: sandwich; 10-12 strands in 2 sheets; jelly roll; may contain inserted subdomains
  4. 1815212Superfamily b.179.1: PA14-like [254123] (3 families) (S)
  5. 1815254Family b.179.1.2: GLEYA domain [254187] (2 proteins)
    Pfam PF10528
    PubMed 21149680; inserted Flo5 subdomain (84-120) contains 5 short beta strands and two disulfide bridges
  6. 1815264Protein automated matches [254737] (2 species)
    not a true protein
  7. 1815265Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256184] (10 PDB entries)
  8. 1815274Domain d4ahza_: 4ahz A: [251034]
    automated match to d2xjra_
    complexed with cl, gd

Details for d4ahza_

PDB Entry: 4ahz (more details), 1.9 Å

PDB Description: flo5a showing a heptanuclear gadolinium cluster on its surface after 60 min of soaking
PDB Compounds: (A:) flocculation protein flo5

SCOPe Domain Sequences for d4ahza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ahza_ b.179.1.2 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
glvprgshmsgateaclpagqrksgmninfyqyslkdsstysnaaymaygyasktklgsv
ggqtdisidynipcvsssgtfpcpqedsygnwgckgmgacsnsqgiaywstdlfgfyttp
tnvtlemtgyflppqtgsytfsfatvddsailsvggsiafeccaqeqppitstnftingi
kpwdgslpdnitgtvymyagyyyplkvvysnavswgtlpisvelpdgttvsdnfegyvys
fdddlsqsnctipdpsih

SCOPe Domain Coordinates for d4ahza_:

Click to download the PDB-style file with coordinates for d4ahza_.
(The format of our PDB-style files is described here.)

Timeline for d4ahza_: