Lineage for d4ahwa1 (4ahw A:23-271)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2434421Fold b.179: Anthrax protective antigen N-terminal-like [254104] (1 superfamily)
    core: sandwich; 10-12 strands in 2 sheets; jelly roll; may contain inserted subdomains
  4. 2434422Superfamily b.179.1: PA14-like [254123] (3 families) (S)
  5. 2434464Family b.179.1.2: GLEYA domain [254187] (2 proteins)
    Pfam PF10528
    PubMed 21149680; inserted Flo5 subdomain (84-120) contains 5 short beta strands and two disulfide bridges
  6. 2434474Protein automated matches [254737] (2 species)
    not a true protein
  7. 2434475Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256184] (10 PDB entries)
  8. 2434481Domain d4ahwa1: 4ahw A:23-271 [251031]
    Other proteins in same PDB: d4ahwa2
    automated match to d2xjra_
    complexed with cl, gd

Details for d4ahwa1

PDB Entry: 4ahw (more details), 1.5 Å

PDB Description: flo5a showing a heptanuclear gadolinium cluster on its surface
PDB Compounds: (A:) flocculation protein flo5

SCOPe Domain Sequences for d4ahwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ahwa1 b.179.1.2 (A:23-271) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
sgateaclpagqrksgmninfyqyslkdsstysnaaymaygyasktklgsvggqtdisid
ynipcvsssgtfpcpqedsygnwgckgmgacsnsqgiaywstdlfgfyttptnvtlemtg
yflppqtgsytfsfatvddsailsvggsiafeccaqeqppitstnftingikpwdgslpd
nitgtvymyagyyyplkvvysnavswgtlpisvelpdgttvsdnfegyvysfdddlsqsn
ctipdpsih

SCOPe Domain Coordinates for d4ahwa1:

Click to download the PDB-style file with coordinates for d4ahwa1.
(The format of our PDB-style files is described here.)

Timeline for d4ahwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ahwa2