Lineage for d4agha_ (4agh A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1897114Fold d.18: ssDNA-binding transcriptional regulator domain [54446] (1 superfamily)
    helix-swapped dimer of beta(4)-alpha motifs
  4. 1897115Superfamily d.18.1: ssDNA-binding transcriptional regulator domain [54447] (5 families) (S)
  5. 1897173Family d.18.1.0: automated matches [191638] (1 protein)
    not a true family
  6. 1897174Protein automated matches [191174] (3 species)
    not a true protein
  7. 1897175Species Magnaporthe oryzae [TaxId:318829] [256183] (1 PDB entry)
  8. 1897176Domain d4agha_: 4agh A: [251026]
    automated match to d1pcfa_

Details for d4agha_

PDB Entry: 4agh (more details), 1.79 Å

PDB Description: Structural features of ssDNA binding protein MoSub1 from Magnaporthe oryzae
PDB Compounds: (A:) mosub1, transcription cofactor

SCOPe Domain Sequences for d4agha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4agha_ d.18.1.0 (A:) automated matches {Magnaporthe oryzae [TaxId: 318829]}
gsqvdaegnpfweisdkrrvgisqfkkmdfinireyyeaggemkpgkkgigltvdqytaf
lkaipainaelrsrghditd

SCOPe Domain Coordinates for d4agha_:

Click to download the PDB-style file with coordinates for d4agha_.
(The format of our PDB-style files is described here.)

Timeline for d4agha_: