Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.18: ssDNA-binding transcriptional regulator domain [54446] (1 superfamily) helix-swapped dimer of beta(4)-alpha motifs |
Superfamily d.18.1: ssDNA-binding transcriptional regulator domain [54447] (5 families) |
Family d.18.1.0: automated matches [191638] (1 protein) not a true family |
Protein automated matches [191174] (3 species) not a true protein |
Species Magnaporthe oryzae [TaxId:318829] [256183] (1 PDB entry) |
Domain d4agha_: 4agh A: [251026] automated match to d1pcfa_ |
PDB Entry: 4agh (more details), 1.79 Å
SCOPe Domain Sequences for d4agha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4agha_ d.18.1.0 (A:) automated matches {Magnaporthe oryzae [TaxId: 318829]} gsqvdaegnpfweisdkrrvgisqfkkmdfinireyyeaggemkpgkkgigltvdqytaf lkaipainaelrsrghditd
Timeline for d4agha_: